PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00023062001
Common NameGSBRNA2T00023062001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 207aa    MW: 21718.9 Da    PI: 8.0875
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00023062001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.41e-352784461
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         + l+cprC+s  tkfCyynny+l qPryfCk+CrryWt+GG+lr+vPvGgg+r++ ++
  GSBRNA2T00023062001 27 EPLPCPRCNSIITKFCYYNNYNLLQPRYFCKSCRRYWTQGGTLRDVPVGGGTRRSSSK 84
                         6789*************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.2E-322883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.8852983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-193378IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MPSESNQTRS ARVQGSTAAY PPPNLAEPLP CPRCNSIITK FCYYNNYNLL QPRYFCKSCR  60
RYWTQGGTLR DVPVGGGTRR SSSKRNRSFS SNATTASSSS CSSSIITTAN GSEPMNQGTA  120
TNEAKGSHEI SGYGSFASLG SGGLDYGFGY GYGLEELSIG YLGGGSGVEI PVVGGGDTWQ  180
IGEIEAKSGD SLWPGLEISM QSNGAK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00189DAPTransfer from AT1G47655Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0889462e-77AY088946.1 Arabidopsis thaliana clone 103581 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013673122.11e-122PREDICTED: dof zinc finger protein DOF1.6
SwissprotQ9SX979e-80DOF16_ARATH; Dof zinc finger protein DOF1.6
TrEMBLA0A078J5M21e-149A0A078J5M2_BRANA; BnaA10g28590D protein
STRINGBra015609.1-P1e-116(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94652435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.15e-50Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]